PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02272.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 308aa    MW: 32361.1 Da    PI: 6.5775
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02272.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.3e-32134191259
                                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     +Dgy+WrKYGqK vk+s+fprsYYrCt  +C+vkk+vers++dp+vv++tYeg+H h+
  Zpz_sc02272.1.g00040.1.sm.mkhc 134 EDGYRWRKYGQKAVKNSPFPRSYYRCTNGKCTVKKRVERSSSDPSVVITTYEGQHCHH 191
                                     8******************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-33118192IPR003657WRKY domain
SuperFamilySSF1182905.1E-28125191IPR003657WRKY domain
PROSITE profilePS5081129.838128193IPR003657WRKY domain
SMARTSM007746.0E-38133192IPR003657WRKY domain
PfamPF031062.0E-25134191IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAGSAGGRDE WLFSANAYDD SSAIFAELGC WAAGLDGACG DLLLPPLDPA PQACGAAEEA  60
VATPAGSAVS VDGGVSSSST DDGAAQEKDA DVKPANDTEA ASEAPAPGKT TKGKKRARQP  120
RFAFMTKSEI DHLEDGYRWR KYGQKAVKNS PFPRSYYRCT NGKCTVKKRV ERSSSDPSVV  180
ITTYEGQHCH HTVTFPRAHL FAGHHHLYSG NDHLPPLQLP TAALLDPLIV SRPAMSSSTS  240
SPTAMLRPLH CNQEIQAATS MYPLSTTTTA PAVAAVSAQS TSAPANDVPA AVDKGLLDDM  300
VPAAMRHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-26123190774Probable WRKY transcription factor 4
2lex_A4e-26123190774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955332.11e-103PREDICTED: probable WRKY transcription factor 32
TrEMBLW5BDM01e-108W5BDM0_WHEAT; Uncharacterized protein
STRINGSi030377m1e-103(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.25e-55WRKY DNA-binding protein 57